PDB entry 5tc2

View 5tc2 on RCSB PDB site
Description: C-terminal domain of HIV-1 integrase, crystal structure
Class: transferase
Keywords: HIV-1 integrase, DNA binding domain, transferase
Deposited on 2016-09-14, released 2018-04-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2KJS6 (1-55)
      • conflict (14)
    Domains in SCOPe 2.08: d5tc2a_
  • Chain 'B':
    Compound: integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2KJS6 (1-55)
      • conflict (14)
    Domains in SCOPe 2.08: d5tc2b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tc2A (A:)
    gkiqnfrvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiirdygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tc2A (A:)
    kiqnfrvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiirdygk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5tc2B (B:)
    gkiqnfrvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiirdygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tc2B (B:)
    kiqnfrvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiirdygk