PDB entry 5tb5

View 5tb5 on RCSB PDB site
Description: Crystal structure of full-length farnesylated and methylated KRAS4b in complex with PDE-delta (crystal form I - with partially disordered hypervariable region)
Class: oncoprotein
Keywords: KRAS4b, PDEdelta, PDE6delta, RAS, KRAS, ONCOPROTEIN
Deposited on 2016-09-11, released 2016-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-184)
      • expression tag (0)
  • Chain 'B':
    Compound: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D, PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tb5b_
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D, PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5tb5d_
  • Heterogens: FAR, GDP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5tb5B (B:)
msakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpa
svltgnviietkffdddllvstsrvrlfyv

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >5tb5D (D:)
msakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavs
relnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpa
svltgnviietkffdddllvstsrvrlfyv

    Sequence, based on observed residues (ATOM records): (download) 
    >5tb5D (D:)
derareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsreln
fssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvlt
gnviietkffdddllvstsrvrlfyv