PDB entry 5t9z

View 5t9z on RCSB PDB site
Description: Discovery of a Potent Cyclophilin Inhibitor (Compound 6) based on Structural Simplification of Sanglifehrin A
Class: isomerase/isomerase inhibitor
Keywords: cyclophilin inhibitor antiviral HCV, isomerase-isomerase inhibitor complex
Deposited on 2016-09-09, released 2017-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase A
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIA, CYPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62937 (0-162)
  Domains in SCOPe 2.08: d5t9za_
• Heterogens: 78R, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5t9zA (A:)
  vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
  cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
  ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgql