PDB entry 5t9x

View 5t9x on RCSB PDB site
Description: Crystal structure of BuGH16Bwt
Class: hydrolase
Keywords: (alpha/beta)6 barrel, glycoside hydrolase, HYDROLASE
Deposited on 2016-09-09, released 2017-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase
    Species: Bacteroides uniformis [TaxId:820]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T9X
    Domains in SCOPe 2.07: d5t9xa_
  • Chain 'B':
    Compound: glycoside hydrolase
    Species: Bacteroides uniformis [TaxId:820]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T9X (Start-342)
    Domains in SCOPe 2.07: d5t9xb_
  • Chain 'C':
    Compound: glycoside hydrolase
    Species: Bacteroides uniformis [TaxId:820]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T9X
    Domains in SCOPe 2.07: d5t9xc_
  • Heterogens: NA, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t9xA (A:)
    mgsshhhhhhssglvprgshmasgdnngeengsengsntdpgdsetefeyewdkfpvpvs
    agtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpaptiwqrdhisvsdgcl
    rietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveayakianstmasdvw
    mlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpfqdyqptdpgswyk
    dvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndftkgtglskemdii
    inmedqswraisglsptnkelmnkdnntflvdwiriykpvedk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9xA (A:)
    setefeyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgp
    aptiwqrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvy
    veayakianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfi
    rdpfqdyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniid
    pndftkgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t9xB (B:)
    mgsshhhhhhssglvprgshmasgdnngeengsengsntdpgdsetefeyewdkfpvpvs
    agtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpaptiwqrdhisvsdgcl
    rietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveayakianstmasdvw
    mlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpfqdyqptdpgswyk
    dvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndftkgtglskemdii
    inmedqswraisglsptnkelmnkdnntflvdwiriykpvedk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9xB (B:)
    feyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpapti
    wqrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveay
    akianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpf
    qdyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndf
    tkgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpvedk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t9xC (C:)
    mgsshhhhhhssglvprgshmasgdnngeengsengsntdpgdsetefeyewdkfpvpvs
    agtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpaptiwqrdhisvsdgcl
    rietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveayakianstmasdvw
    mlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpfqdyqptdpgswyk
    dvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndftkgtglskemdii
    inmedqswraisglsptnkelmnkdnntflvdwiriykpvedk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9xC (C:)
    eyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpaptiw
    qrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveaya
    kianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpfq
    dyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndft
    kgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpved