PDB entry 5t9b

View 5t9b on RCSB PDB site
Description: Crystal structure of B. subtilis 168 GlpQ in complex with glycerol-3-phosphate (5 minute soak)
Class: hydrolase
Keywords: hydrolase, metal binding protein
Deposited on 2016-09-09, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Glycerophosphoryl diester phosphodiesterase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: glpQ, ybeD, BSU02130
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t9bg_
  • Heterogens: CA, G3P, NA, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5t9bG (G:)
    gaskgnllspdriltvahrgasgyvpehtilsyetaqkmkadfieldlqmtkdgklivmh
    dekldrttngmgwvkdhtladikkldagswfneaypekakpqyvglkvptleevldrfgk
    hanyyietkspdtypgmeekliaslqkhkllgkhskpgqviiqsfskeslvkvhqlqpnl
    ptvqlleakqmasmtdaaleeiktyavgagpdykalnqenvrmirshglllhpytvnnea
    dmhrlldwgvtgvftnypdlfhkvkkgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t9bG (G:)
    nllspdriltvahrgasgyvpehtilsyetaqkmkadfieldlqmtkdgklivmhdekld
    rttngmgwvkdhtladikkldagswfneaypekakpqyvglkvptleevldrfgkhanyy
    ietkspdtypgmeekliaslqkhkllkpgqviiqsfskeslvkvhqlqpnlptvqlleak
    qmasmtdaaleeiktyavgagpdykalnqenvrmirshglllhpytvnneadmhrlldwg
    vtgvftnypdlfhkvkkgy