PDB entry 5t93
View 5t93 on RCSB PDB site
Description: Immunoglobulin light chain variable domain AL-T05
Class: immune system
Keywords: immunoglobulin light chain, amyloid, light chain amyloidosis, variable domain, antibodies, IMMUNE SYSTEM
Deposited on
2016-09-09, released
2017-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-09-20, with a file datestamp of
2017-09-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
Species: Homo sapiens [TaxId:9606]
Gene: IGLV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5t93a_ - Chain 'B':
Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
Species: Homo sapiens [TaxId:9606]
Gene: IGLV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5t93b_ - Chain 'C':
Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
Species: Homo sapiens [TaxId:9606]
Gene: IGLV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5t93c_ - Chain 'D':
Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
Species: Homo sapiens [TaxId:9606]
Gene: IGLV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5t93d_ - Heterogens: ZN, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5t93A (A:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5t93B (B:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5t93C (C:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5t93D (D:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl