PDB entry 5t93

View 5t93 on RCSB PDB site
Description: Immunoglobulin light chain variable domain AL-T05
Class: immune system
Keywords: immunoglobulin light chain, amyloid, light chain amyloidosis, variable domain, antibodies, IMMUNE SYSTEM
Deposited on 2016-09-09, released 2017-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV
    Database cross-references and differences (RAF-indexed):
    • PDB 5T93 (0-109)
    Domains in SCOPe 2.08: d5t93a_
  • Chain 'B':
    Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV
    Database cross-references and differences (RAF-indexed):
    • PDB 5T93 (0-109)
    Domains in SCOPe 2.08: d5t93b_
  • Chain 'C':
    Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV
    Database cross-references and differences (RAF-indexed):
    • PDB 5T93 (0-109)
    Domains in SCOPe 2.08: d5t93c_
  • Chain 'D':
    Compound: ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLV
    Database cross-references and differences (RAF-indexed):
    • PDB 5T93 (0-109)
    Domains in SCOPe 2.08: d5t93d_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5t93A (A:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5t93B (B:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5t93C (C:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5t93D (D:)
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl