PDB entry 5t8w

View 5t8w on RCSB PDB site
Description: Cytochrome c - calixarene free
Class: electron transport
Keywords: cytochrome c, P212121, electron transport
Deposited on 2016-09-08, released 2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyc1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, H834_YJM1574J00260
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C6AZG8 (0-107)
      • conflict (0)
      • conflict (106)
    Domains in SCOPe 2.08: d5t8wa_
  • Chain 'B':
    Compound: Cyc1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, H834_YJM1574J00260
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0C6AZG8 (0-107)
      • conflict (0)
      • conflict (106)
    Domains in SCOPe 2.08: d5t8wb_
  • Heterogens: HEC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t8wA (A:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5t8wB (B:)
    aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate