PDB entry 5t8w
View 5t8w on RCSB PDB site
Description: Cytochrome c - calixarene free
Class: electron transport
Keywords: cytochrome c, P212121, electron transport
Deposited on
2016-09-08, released
2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-02-28, with a file datestamp of
2018-02-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cyc1p
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: CYC1, H834_YJM1574J00260
Database cross-references and differences (RAF-indexed):
- Uniprot A0A0C6AZG8 (0-107)
- conflict (0)
- conflict (106)
Domains in SCOPe 2.08: d5t8wa_ - Chain 'B':
Compound: Cyc1p
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: CYC1, H834_YJM1574J00260
Database cross-references and differences (RAF-indexed):
- Uniprot A0A0C6AZG8 (0-107)
- conflict (0)
- conflict (106)
Domains in SCOPe 2.08: d5t8wb_ - Heterogens: HEC, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5t8wA (A:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5t8wB (B:)
aefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate