PDB entry 5t7t

View 5t7t on RCSB PDB site
Description: Galectin-8 N terminal domain in complex with LNT
Class: sugar binding protein
Keywords: carbohydrate binding protein, galectin-8 lectin, SUGAR BINDING PROTEIN
Deposited on 2016-09-05, released 2017-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214
      • engineered mutation (55)
    Domains in SCOPe 2.08: d5t7ta_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5t7tA (A:)
mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpra
dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
khtllyghrigpekidtlgiygkvnihsigfsfss

    Sequence, based on observed residues (ATOM records): (download) 
    >5t7tA (A:)
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsfs