PDB entry 5t7h

View 5t7h on RCSB PDB site
Description: Crystal structure of dimeric yeast iso-1-cytochrome C with CYMAL6
Class: electron transport
Keywords: cytochrome C, peroxidase activity, CYMAL6, ELECTRON TRANSPORT
Deposited on 2016-09-05, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-108)
      • engineered mutation (77)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5t7ha_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-108)
      • engineered mutation (77)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5t7hb_
  • Chain 'C':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-108)
      • engineered mutation (77)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5t7hc_
  • Chain 'D':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-108)
      • engineered mutation (77)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5t7hd_
  • Heterogens: SO4, ZE7, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t7hA (A:)
    mtefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanik
    knvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t7hA (A:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t7hB (B:)
    mtefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanik
    knvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t7hB (B:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t7hC (C:)
    mtefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanik
    knvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t7hC (C:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5t7hD (D:)
    mtefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanik
    knvlwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t7hD (D:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgtkmafgglkkekdrndlitylkkase