PDB entry 5t68

View 5t68 on RCSB PDB site
Description: Crystal structure of Syk catalytic domain in complex with a furo[3,2-d]pyrimidine
Class: Transferase/Transferase Inhibitor
Keywords: Spleen Tyrosine Kinase Syk catalytic domain, Transferase-Transferase Inhibitor complex
Deposited on 2016-09-01, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • expression tag (283-284)
    Domains in SCOPe 2.07: d5t68a1, d5t68a2
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t68b_
  • Heterogens: 77V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t68A (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t68A (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrnyyydvvneg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t68B (B:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t68B (B:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrnyyydvvn