PDB entry 5t5x

View 5t5x on RCSB PDB site
Description: High resolution structure of mouse Cryptochrome 1
Class: transcription
Keywords: repressor, transcription, circadian
Deposited on 2016-08-31, released 2017-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome-1
    Species: Mus musculus [TaxId:10090]
    Gene: CRY1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t5xa1, d5t5xa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t5xA (A:)
    mgvnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcle
    dldanlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklatea
    gvevivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmt
    plsddhdekygvpsleelgfdtdglssavwpggetealtrlerhlerkawvanferprmn
    ansllasptglspylrfgclscrlfyfkltdlykkvkknsspplslygqllwreffytaa
    tnnprfdkmegnpicvqipwdknpealakwaegrtgfpwidaimtqlrqegwihhlarha
    vacfltrgdlwisweegmkvfeellldadwsinagswmwlscssffqqffhcycpvgfgr
    rtdpngdyirrylpvlrgfpakyiydpwnapegiqkvakcligvnypkpmvnhaeasrln
    iermkqiyqql
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t5xA (A:)
    vnavhwfrkglrlhdnpalkeciqgadtircvyilvginrwrfllqcledldanlrklns
    rlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivrisht
    lydldkiielnggqppltykrfqtlvskmepitsdvigkcmtplsddhdekygvpsleel
    gfdtdglssavwpggetealtrlerhlerkawvanprmnansllasptglspylrfgcls
    crlfyfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwd
    knpealakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvf
    eellldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpa
    kyiydpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql