PDB entry 5t5v

View 5t5v on RCSB PDB site
Description: lipoxygenase-1 (soybean) at 293k
Class: oxidoreductase
Keywords: lipoxygenase, hydrogen tunneling, OXIDOREDUCTASE
Deposited on 2016-08-31, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • conflict (159)
    Domains in SCOPe 2.06: d5t5va1, d5t5va2
  • Chain 'B':
    Compound: Seed linoleate 13S-lipoxygenase-1
    Species: Glycine max [TaxId:3847]
    Gene: LOX1.1, LOX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08170 (Start-838)
      • conflict (159)
    Domains in SCOPe 2.06: d5t5vb1, d5t5vb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t5vA (A:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t5vA (A:)
    hkikgtvvlmpknelevvdnlnaflgrsvslqlisatkadahgkgkvgkdtflegintsl
    ptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswv
    yntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvynd
    lgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlks
    kdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplp
    vikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnl
    dpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyat
    rtilflredgtlkpvaielslphvsqvvlpakegvestiwllakayvivndscyhqlmsh
    wlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflp
    skysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwa
    aiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevc
    liiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtit
    sklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrr
    nndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t5vB (B:)
    mfsaghkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgk
    dtflegintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnq
    gtirfvcnswvyntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkey
    driydydvyndlgnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyv
    prdenlghlkskdaleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklp
    rdvistiiplpvikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvir
    gleefppksnldpaiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqi
    nqlnsaktyatrtilflredgtlkpvaielslphsagdlsaavsqvvlpakegvestiwl
    lakayvivndscyhqlmshwlnthaamepfviathrhlsvlhpiyklltphyrnnmnina
    larqslinangiiettflpskysvemssavyknwvftdqalpadlikrgvaikdpstphg
    vrlliedypyaadgleiwaaiktwvqeyvplyyardddvkndselqhwwkeavekghgdl
    kdkpwwpklqtledlvevcliiiwiasalhaavnfgqypygglimnrptasrrllpekgt
    peyeeminnhekaylrtitsklptlislsvieilsthasdevylgqrdnphwtsdskalq
    afqkfgnklkeieeklvrrnndpslqgnrlgpvqlpytllypsseegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t5vB (B:)
    ghkikgtvvlmpknelevnlnaflgrsvslqlisatkadahgkgkvgkdtflegintslp
    tlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfvcnswvy
    ntklyksvriffanhtyvpsetpaplveyreeelkslrgngtgerkeydriydydvyndl
    gnpdkseklarpvlggsstfpyprrgrtgrgptvtdpntekqgevfyvprdenlghlksk
    daleigtkslsqivqpafesafdlkstpiefhsfqdvhdlyeggiklprdvistiiplpv
    ikelyrtdgqhilkfpqphvvqvsqsawmtdeefaremiagvnpcvirgleefppksnld
    paiygdqsskitadsldldgytmdealgsrrlfmldyhdifmpyvrqinqlnsaktyatr
    tilflredgtlkpvaielslphavsqvvlpakegvestiwllakayvivndscyhqlmsh
    wlnthaamepfviathrhlsvlhpiyklltphyrnnmninalarqslinangiiettflp
    skysvemssavyknwvftdqalpadlikrgvaikdpstphgvrlliedypyaadgleiwa
    aiktwvqeyvplyyardddvkndselqhwwkeavekghgdlkdkpwwpklqtledlvevc
    liiiwiasalhaavnfgqypygglimnrptasrrllpekgtpeyeeminnhekaylrtit
    sklptlislsvieilsthasdevylgqrdnphwtsdskalqafqkfgnklkeieeklvrr
    nndpslqgnrlgpvqlpytllypsseegltfrgipnsisi