PDB entry 5t4v

View 5t4v on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRPF1 in complex with NI-48 ligand
Class: transcription
Keywords: Transcription, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2016-08-30, released 2017-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t4va_
  • Heterogens: N48, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5t4vA (A:)
smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg

    Sequence, based on observed residues (ATOM records): (download) 
    >5t4vA (A:)
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm