PDB entry 5t2y

View 5t2y on RCSB PDB site
Description: Crystal Structure of C. jejuni PglD in complex with 5-methyl-4-(methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid
Class: transferase/transferase inhibitor
Keywords: Campylobacter jejuni bacterial acetyltransferase inhibitor complex, transferase-transferase inhibitor complex
Deposited on 2016-08-24, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylbacillosamine N-acetyltransferase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: pglD, Cj1123c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t2ya_
  • Chain 'B':
    Compound: UDP-N-acetylbacillosamine N-acetyltransferase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) [TaxId:192222]
    Gene: pglD, Cj1123c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t2yb_
  • Heterogens: 753, GOL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t2yA (A:)
    gsamartekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaign
    neirkkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvil
    ntssviehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatl
    vknqdekgvfvgvpakrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t2yA (A:)
    artekiyiygasghglvcedvaknmgykeciflddfmkfestlpkydffiaignneirkk
    iyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvi
    ehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqde
    kgvfvgvpakrm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t2yB (B:)
    gsamartekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaign
    neirkkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvil
    ntssviehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatl
    vknqdekgvfvgvpakrm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t2yB (B:)
    artekiyiygasghglvcedvaknmgykeciflddfmkfestlpkydffiaignneirkk
    iyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssvi
    ehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqde
    kgvfvgvpakrm