PDB entry 5t20

View 5t20 on RCSB PDB site
Description: Crystal Structure of Tarin Lectin bound to Trimannose
Class: sugar binding protein
Keywords: Tarin, GNA-related Lectin, SUGAR BINDING PROTEIN
Deposited on 2016-08-22, released 2016-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20a_
  • Chain 'B':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20b_
  • Chain 'C':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20c_
  • Chain 'D':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20d_
  • Chain 'E':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20e_
  • Chain 'F':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20f_
  • Chain 'G':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20g_
  • Chain 'H':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20h_
  • Chain 'I':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20i_
  • Chain 'J':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20j_
  • Chain 'K':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20k_
  • Chain 'L':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20l_
  • Chain 'M':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20m_
  • Chain 'N':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20n_
  • Chain 'O':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5t20o_
  • Chain 'P':
    Compound: lectin
    Species: Colocasia esculenta [TaxId:4460]
    Database cross-references and differences (RAF-indexed):
    • PDB 5T20 (0-End)
    Domains in SCOPe 2.08: d5t20p_
  • Heterogens: MAN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t20A (A:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20A (A:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t20B (B:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20B (B:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t20C (C:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20C (C:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5t20D (D:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20D (D:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5t20E (E:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20E (E:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5t20F (F:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20F (F:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5t20G (G:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20G (G:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5t20H (H:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20H (H:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5t20I (I:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20I (I:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5t20J (J:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20J (J:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5t20K (K:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20K (K:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5t20L (L:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20L (L:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5t20M (M:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20M (M:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5t20N (N:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20N (N:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5t20O (O:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20O (O:)
    lgtnyllsgqtlntdghlkngdfdlvmqndcnlvlyngnwqsntanngrdckltltdyge
    lvikngdgstvwrsraksvkgnyaavlhpdgrlvvfgpsvfkidpwvp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5t20P (P:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwetsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t20P (P:)
    nipftdnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
    nhkgeliikdddfktiwssnssskqgdyvlilrddgfaviygpaiwets