PDB entry 5t19

View 5t19 on RCSB PDB site
Description: Structure of PTP1B complexed with N-(3'-(1,1-dioxido-4-oxo-1,2,5-thiadiazolidin-2-yl)-4'-methyl-[1,1'-biphenyl]-4-yl)acetamide
Class: hydrolase
Keywords: HYDROLASE, protein tyrosine phosphatase, 5-(aryl)-1, 2, 5-thiadiazolidin-3-one-1, 1-dioxide unit
Deposited on 2016-08-18, released 2017-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5t19a1, d5t19a2
  • Heterogens: MG, 73U, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t19A (A:)
    ghmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsrik
    lhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgs
    lkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytt
    wpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkr
    kdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    lepppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t19A (A:)
    ghmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsrik
    lhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgs
    lkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytt
    wpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkr
    kdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed