PDB entry 5t08

View 5t08 on RCSB PDB site
Description: Crystal structure of H6 hemagglutinin G225D mutant from Taiwan (2013) H6N1 influenza virus
Class: immune system
Keywords: Influenza virus, hemagglutinin, HA, Taiwan (2013) H6N1, Receptor specificity, IMMUNE SYSTEM
Deposited on 2016-08-15, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08c_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08e_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: H6N1 subtype [TaxId:119212]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5t08f_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5t08A (A:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08A (A:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
    etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
    plwigecpkyvkseslrlatglrnvpqiat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5t08B (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08B (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5t08C (C:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08C (C:)
    gdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
    wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
    stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
    vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpge
    tlnvesngnliapwyaykfvskgavfksdlpiencdatcqtitgvlrtnktfqnvsplwi
    gecpkyvkseslrlatglrnvpqia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5t08D (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08D (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5t08E (E:)
    adpgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdct
    iegwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfem
    fpkstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpily
    fwgvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlr
    pgetlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqn
    vsplwigecpkyvkseslrlatglrnvpqiatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08E (E:)
    pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
    gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
    kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
    gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
    etlnvesngnliapwyaykfvskkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5t08F (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgiegrlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5t08F (F:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg