PDB entry 5sy9

View 5sy9 on RCSB PDB site
Description: Atomic resolution structure of E15Q mutant human DJ-1
Class: protein binding
Keywords: DJ-1/PfpI superfamily oxidative stress nucleophile elbow, PROTEIN BINDING
Deposited on 2016-08-10, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein deglycase DJ-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99497 (3-End)
      • engineered mutation (17)
    Domains in SCOPe 2.07: d5sy9a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sy9A (A:)
    gshmaskralvilakgaqemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdas
    ledakkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallahei
    gfgskvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkev
    aaqvkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sy9A (A:)
    maskralvilakgaqemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlk