PDB entry 5sy4

View 5sy4 on RCSB PDB site
Description: Atomic resolution structure of reduced E. coli YajL
Class: chaperone
Keywords: DJ-1/PfpI superfamily nucleophile elbow, CHAPERONE
Deposited on 2016-08-10, released 2016-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone YajL
    Species: Escherichia coli [TaxId:562]
    Gene: thiJ, ACU57_11870, AM266_04520, ERS085365_02411, ERS085416_01937, ERS139211_01908, ERS150873_01827, PU15_11320, PU38_04800, SK85_00449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5sy4a_
  • Chain 'B':
    Compound: Chaperone YajL
    Species: Escherichia coli [TaxId:562]
    Gene: thiJ, ACU57_11870, AM266_04520, ERS085365_02411, ERS085416_01937, ERS139211_01908, ERS150873_01827, PU15_11320, PU38_04800, SK85_00449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5sy4b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sy4A (A:)
    gshmsasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvkllada
    plvevadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphd
    ifpignmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrek
    ahevasqlvmaagiynyye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sy4A (A:)
    sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
    vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
    gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
    asqlvmaagiynyye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5sy4B (B:)
    gshmsasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvkllada
    plvevadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphd
    ifpignmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrek
    ahevasqlvmaagiynyye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sy4B (B:)
    sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
    vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
    gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
    asqlvmaagiynyye