PDB entry 5sx4

View 5sx4 on RCSB PDB site
Description: Crystal Structure of panitumumab in complex with epidermal growth factor receptor domain 3.
Class: transferase/immune system
Keywords: Cetuximab, panitumumab, EGFR, Vectibix, Erbitux, TRANSFERASE-IMMUNE SYSTEM complex
Deposited on 2016-08-09, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Panitumumab Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SX4 (0-End)
  • Chain 'I':
    Compound: Panitumumab Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SX4 (0-End)
    Domains in SCOPe 2.07: d5sx4i1, d5sx4i2
  • Chain 'J':
    Compound: Panitumumab Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SX4 (0-End)
  • Chain 'L':
    Compound: Panitumumab Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SX4 (0-End)
    Domains in SCOPe 2.07: d5sx4l1, d5sx4l2
  • Chain 'M':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (Start-194)
      • conflict (21)
      • conflict (113)
      • expression tag (195)
    Domains in SCOPe 2.07: d5sx4m1, d5sx4m2, d5sx4m3
  • Chain 'N':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (4-194)
      • expression tag (3)
      • conflict (21)
      • conflict (113)
    Domains in SCOPe 2.07: d5sx4n1, d5sx4n2, d5sx4n3
  • Heterogens: SO4, GOL, 1PE, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5sx4I (I:)
    diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
    rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx4I (I:)
    diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
    rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5sx4L (L:)
    diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
    rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx4L (L:)
    diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
    rfsgsgsgtdftftisslqpediatyfcqhfdhlplafgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5sx4M (M:)
    leekkvcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx4M (M:)
    vcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
    ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslke
    isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspegc
    wgpeprdcvsh
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5sx4N (N:)
    leekkvcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpq
    eldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslgl
    rslkeisdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalc
    spegcwgpeprdcvshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sx4N (N:)
    kkvcnfkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvk
    eitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslkeisdg
    dviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgqvchalcspegcwgpe
    prdcvs