PDB entry 5sw7

View 5sw7 on RCSB PDB site
Description: Structure of the Human Hemoglobin Mutant Hb Providence (A-Gly-C:V1M; B,D:V1M,K82D; Ferrous, carbonmonoxy bound)
Class: oxygen transport
Keywords: Heme, oxygen transport, distal histidine, oxidative stability
Deposited on 2016-08-08, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HBA1, HBA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered mutation (0)
      • linker (141)
    Domains in SCOPe 2.07: d5sw7a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered mutation (0)
      • engineered mutation (81)
    Domains in SCOPe 2.07: d5sw7b_
  • Heterogens: HEM, CMO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5sw7A (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5sw7B (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnldgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh