PDB entry 5sw4

View 5sw4 on RCSB PDB site
Description: crystal structure of native catalase-peroxidase katg at ph8.0
Deposited on 2016-08-08, released 2016-08-24
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, NA, OXY, PO4, MPD, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.75, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5sw4A (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records):
    >5sw4A (A:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5sw4B (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsglevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records):
    >5sw4B (B:)
    gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
    padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
    kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
    nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
    agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
    qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
    payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavdh
    plidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwea
    nqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpfa
    pgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvll
    gglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratgel
    kwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla