PDB entry 5svh

View 5svh on RCSB PDB site
Description: Crystal structure of the KIX domain of CBP in complex with a MLL/c-Myb chimera
Class: transcription
Keywords: Transcription, CBP, complex
Deposited on 2016-08-06, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5svha_
  • Chain 'B':
    Compound: MLL/c-Myb chimera
    Species: Homo sapiens, Gallus gallus [TaxId:9606, 9031]
    Gene: KMT2A, ALL1, CXXC7, HRX, HTRX, MLL, MLL1, TRX1, MYB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5svhA (A:)
    gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
    rdeyyhllaekiykiqkeleekrrsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5svhA (A:)
    rkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesansrd
    eyyhllaekiykiqkeleekrrsrl
    

  • Chain 'B':
    No sequence available.