PDB entry 5sv4

View 5sv4 on RCSB PDB site
Description: Anti-Ricin A-chain Single Domain Antibody A3C8
Class: toxin
Keywords: single domain antibody, sdAb, ricin, A-chain, TOXIN
Deposited on 2016-08-04, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody A3C8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SV4
    Domains in SCOPe 2.07: d5sv4a_
  • Chain 'B':
    Compound: Single Domain Antibody A3C8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SV4
    Domains in SCOPe 2.07: d5sv4b1, d5sv4b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sv4A (A:)
    maevqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiit
    dyadsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgq
    gtqvtvssaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sv4A (A:)
    evqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiitdy
    adsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgqgt
    qvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5sv4B (B:)
    maevqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiit
    dyadsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgq
    gtqvtvssaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sv4B (B:)
    evqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiitdy
    adsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgqgt
    qvtvssaa