PDB entry 5sv3

View 5sv3 on RCSB PDB site
Description: RTA1-33/44-198 (RVEC) bound to Single Domain Antibody A3C8
Class: toxin
Keywords: Ricin, A-chain, RVEC, sdAb, antibody, RTA1-33/44-198, TOXIN
Deposited on 2016-08-04, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SV3
    Domains in SCOPe 2.07: d5sv3a_
  • Chain 'B':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Anti-Ricin A-chain Single Domain Antibody (sdAb) A3C8
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5SV3
    Domains in SCOPe 2.07: d5sv3c_
  • Chain 'D':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5sv3A (A:)
    maevqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiit
    dyadsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgq
    gtqvtvssaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sv3A (A:)
    evqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiitdy
    adsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgqgt
    qvtvss
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5sv3C (C:)
    maevqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiit
    dyadsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgq
    gtqvtvssaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5sv3C (C:)
    vqlvesggglvqagdslrlsctasgrtlgdygvawfrqapgkerefvsvisrstiitdya
    dsvrgrfsisadsakntvylqmnslkpedtavyycavianpvyatsrnsddyghwgqgtq
    vtvss
    

  • Chain 'D':
    No sequence available.