PDB entry 5sga

View 5sga on RCSB PDB site
Description: Structures of product and inhibitor complexes of Streptomyces griseus protease a at 1.8 Angstroms resolution. a model for serine protease catalysis
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1990-05-29, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.116
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: proteinase a (sgpa)
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00776 (0-180)
      • conflict (131)
    Domains in SCOPe 2.08: d5sgae_
  • Chain 'P':
    Compound: tetrapeptide ace-pro-ala-pro-tyr
    Database cross-references and differences (RAF-indexed):
    • PDB 5SGA (Start-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5sgaE (E:)
    iaggeaittggsrcslgfnvsvngvahaltaghctnisaswsigtrtgtsfpnndygiir
    hsnpaaadgrvylyngsyqdittagnafvgqavqrsgsttglrsgsvtglnatvnygssg
    ivygmiqtnvcaqpgdsggslfagstalgltsggsgncrtggttfyqpvtealsaygatv
    l
    

  • Chain 'P':
    No sequence available.