PDB entry 5sbv

View 5sbv on RCSB PDB site
Description: CD44 PanDDA analysis group deposition -- The hyaluronan-binding domain of CD44 in complex with Z31721798
Class: protein binding
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, antigen, PROTEIN BINDING
Deposited on 2021-09-14, released 2021-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-09-22, with a file datestamp of 2021-09-17.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD44 antigen
    Species: Mus musculus [TaxId:10090]
    Gene: Cd44, Ly-24
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15379 (2-151)
      • initiating methionine (0)
      • expression tag (1)
    Domains in SCOPe 2.08: d5sbva1, d5sbva2
  • Heterogens: NW4, DMS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5sbvA (A:)
mnqidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcr
ygfiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpn
sfdgpvtitivnrdgtryskkgeyrthqedid

    Sequence, based on observed residues (ATOM records): (download) 
    >5sbvA (A:)
nqidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcry
gfiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpns
fdgpvtitivnrdgtryskkgeyrthqedi