PDB entry 5s8d

View 5s8d on RCSB PDB site
Description: XChem group deposition -- Crystal Structure of the second bromodomain of pleckstrin homology domain interacting protein (PHIP) in complex with N00539e (space group C2)
Class: signaling protein
Keywords: SGC - Diamond I04-1 fragment screening, bromodomain, PHIP, XChemExplorer, SIGNALING PROTEIN
Deposited on 2020-12-17, released 2021-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PH-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PHIP, DCAF14, WDR11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5s8da_
  • Heterogens: N1E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5s8dA (A:)
    smsydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretlea
    gnyespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfh
    krntitkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5s8dA (A:)
    ydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretleagny
    espmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfhkr