PDB entry 5rhs

View 5rhs on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of Zika virus NS3 Helicase in complex with Z274555794
Class: viral protein
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, VIRAL PROTEIN
Deposited on 2020-05-25, released 2020-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS3 helicase
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5rhsa1, d5rhsa2
  • Heterogens: NZ4, EDO, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5rhsA (A:)
    mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
    ymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyis
    trvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwf
    vpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadr
    vidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetde
    ghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdlp
    vwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcsd
    haalksfkefaagkr