PDB entry 5rhn

View 5rhn on RCSB PDB site
Description: histidine triad nucleotide-binding protein (hint) from rabbit complexed with 8-br-amp
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein
Deposited on 1997-02-26, released 1997-06-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.162
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine triad nucleotide-binding protein
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: HINT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5rhna_
  • Heterogens: 8BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5rhnA (A:)
rpggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedade
sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg