PDB entry 5r86

View 5r86 on RCSB PDB site
Description: PanDDA analysis group deposition INTERLEUKIN-1 BETA -- Fragment Z943693514 in complex with INTERLEUKIN-1 BETA
Class: signaling protein
Keywords: IL-1 BETA, Signaling Protein, SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer
Deposited on 2020-03-03, released 2020-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: IL1B, IL1F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5r86a_
  • Heterogens: GT4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5r86A (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflggtkggqditdftmqfvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5r86A (A:)
    apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
    glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
    yistsqaenmpvflgggqditdftmqfvs