PDB entry 5r4j

View 5r4j on RCSB PDB site
Description: PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF in complex with FMOPL000280a
Class: transcription
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, XChemExplorer, BROMODOMAIN, BPTF, FALZ, FAC1, BROMODOMAIN AND PHD FINGER-CONTAINING TRANSCRIPTION FACTOR, FETAL ALZ-50 CLONE 1 PROTEIN, TRANSCRIPTION
Deposited on 2020-02-24, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleosome-remodeling factor subunit BPTF
    Species: Homo sapiens [TaxId:9606]
    Gene: BPTF, FAC1, FALZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5r4ja_
  • Heterogens: RUY, DMS, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5r4jA (A:)
    smstedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdl
    atmeervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkas
    rsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5r4jA (A:)
    edamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatme
    ervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasrsh