PDB entry 5r41

View 5r41 on RCSB PDB site
Description: PanDDA analysis group deposition -- Auto-refined data of Endothiapepsin for ground state model 61, DMSO-Free
Class: hydrolase
Keywords: hydrolase
Deposited on 2020-03-11, released 2020-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5r41a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5r41A (A:)
    mssplknalvtamlaggalssptkqhvgipvnaspevgpgkysfkqvrnpnykfngplsv
    kktylkygvpipawledavqnstsglaerstgsatttpidslddayitpvqigtpaqtln
    ldfdtgssdlwvfssettasevdgqtiytpsksttakllsgatwsisygdgssssgdvyt
    dtvsvggltvtgqavesakkvsssftedstidgllglafstlntvsptqqktffdnakas
    ldspvftadlgyhapgtynfgfidttaytgsitytavstkqgfwewtstgyavgsgtfks
    tsidgiadtgttllylpatvvsaywaqvsgakssssvggyvfpcsatlpsftfgvgsari
    vipgdyidfgpistgssscfggiqssagiginifgdvalkaafvvfngattptlgfask
    

    Sequence, based on observed residues (ATOM records): (download)
    >5r41A (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask