PDB entry 5r2u

View 5r2u on RCSB PDB site
Description: PanDDA analysis group deposition -- Auto-refined data of Endothiapepsin for ground state model 18, DMSO-Free
Class: hydrolase
Keywords: hydrolase
Deposited on 2020-03-11, released 2020-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 1.1400000000000001 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5r2ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5r2uA (A:)
    mssplknalvtamlaggalssptkqhvgipvnaspevgpgkysfkqvrnpnykfngplsv
    kktylkygvpipawledavqnstsglaerstgsatttpidslddayitpvqigtpaqtln
    ldfdtgssdlwvfssettasevdgqtiytpsksttakllsgatwsisygdgssssgdvyt
    dtvsvggltvtgqavesakkvsssftedstidgllglafstlntvsptqqktffdnakas
    ldspvftadlgyhapgtynfgfidttaytgsitytavstkqgfwewtstgyavgsgtfks
    tsidgiadtgttllylpatvvsaywaqvsgakssssvggyvfpcsatlpsftfgvgsari
    vipgdyidfgpistgssscfggiqssagiginifgdvalkaafvvfngattptlgfask
    

    Sequence, based on observed residues (ATOM records): (download)
    >5r2uA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask