PDB entry 5qzg

View 5qzg on RCSB PDB site
Description: PanDDA analysis group deposition -- Auto-refined data of Aar2/RNaseH for ground state model 31
Class: splicing
Keywords: FragMAX, FragMAXapp, fragment screening, RNaseH like domain, VHS like domain, U5 snRNP assembly, SPLICING, F2X-Entry
Deposited on 2020-03-29, released 2020-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33334 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5qzga1, d5qzga2
  • Chain 'B':
    Compound: A1 cistron-splicing factor AAR2
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: AAR2, YBL074C, YBL06.06, YBL0611
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32357 (4-155)
      • linker (160)
    • Uniprot P32357 (161-307)
    Domains in SCOPe 2.07: d5qzgb1, d5qzgb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qzgA (A:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqnika
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qzgA (A:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5qzgB (B:)
    gamamntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmry
    gywfdcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwyn
    ltefvqmdkirkivrkdenqfsyvdssmttvqenelsssssdpahslnytvinfksreai
    rpghemedfldksyylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamiel
    icssatvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqknslhntekim
    enkypell
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qzgB (B:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenelsdpahslnytvinfksreairpghemed
    fldksyylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamielicssatvp
    khmldkldeilyyqiktlpeqysdillnervwniclyssfqknslhntekimenkypell