PDB entry 5qua

View 5qua on RCSB PDB site
Description: Crystal Structure of swapped human Nck SH3.1 domain, 1.5A, C2221
Class: signaling protein
Keywords: sh3 domain, adaptor, peptide binding, signaling protein, domain swap
Deposited on 2020-01-28, released 2020-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-30, with a file datestamp of 2021-06-25.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5quaa_
  • Chain 'B':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5quab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5quaA (A:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5quaA (A:)
    vvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5quaB (B:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5quaB (B:)
    aeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk