PDB entry 5qu6

View 5qu6 on RCSB PDB site
Description: Crystal Structure of swapped human Nck SH3.1 domain, 1.8A, triclinic
Class: signaling protein
Keywords: sh3 domain, adaptor, peptide binding, signaling protein, domain swap
Deposited on 2020-01-28, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu61_
  • Chain '2':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu62_
  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6a_
  • Chain 'B':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6b_
  • Chain 'C':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6c_
  • Chain 'D':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6d_
  • Chain 'E':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-End)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu6e1, d5qu6e2
  • Chain 'F':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6f_
  • Chain 'G':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6g_
  • Chain 'H':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6h_
  • Chain 'I':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6i_
  • Chain 'J':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6j_
  • Chain 'K':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-End)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu6k1, d5qu6k2
  • Chain 'L':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-End)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu6l1, d5qu6l2
  • Chain 'M':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6m_
  • Chain 'N':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6n_
  • Chain 'O':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-End)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu6o1, d5qu6o2
  • Chain 'P':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6p_
  • Chain 'Q':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6q_
  • Chain 'R':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6r_
  • Chain 'S':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6s_
  • Chain 'T':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6t_
  • Chain 'U':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6u_
  • Chain 'V':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6v_
  • Chain 'W':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6w_
  • Chain 'X':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6x_
  • Chain 'Y':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6y_
  • Chain 'Z':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu6z_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >5qu61 (1:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu61 (1:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >5qu62 (2:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu62 (2:)
    evvvvakfdyldikknerlwllddskswwrvrnsmnktgfvpsnyv
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qu6A (A:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6A (A:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5qu6B (B:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6B (B:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5qu6C (C:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6C (C:)
    eevvvvakfdyvaqqeqeldikknerlwlldskswwrvrnsmnktgfvpsnyver
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5qu6D (D:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6D (D:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5qu6E (E:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6E (E:)
    smaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5qu6F (F:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6F (F:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5qu6G (G:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6G (G:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5qu6H (H:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6H (H:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkns
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5qu6I (I:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6I (I:)
    aeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5qu6J (J:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6J (J:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkns
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5qu6K (K:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6K (K:)
    smaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5qu6L (L:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6L (L:)
    smaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5qu6M (M:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6M (M:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5qu6N (N:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6N (N:)
    aeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5qu6O (O:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6O (O:)
    smaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5qu6P (P:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6P (P:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5qu6Q (Q:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6Q (Q:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5qu6R (R:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6R (R:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5qu6S (S:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6S (S:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5qu6T (T:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6T (T:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5qu6U (U:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6U (U:)
    evvvvakfdyvaqqeqeldikknerlwllkswwrvrnsmnktgfvpsnyverk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5qu6V (V:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6V (V:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5qu6W (W:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6W (W:)
    vvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5qu6X (X:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6X (X:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5qu6Y (Y:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6Y (Y:)
    evvvvakfdyvaqdikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >5qu6Z (Z:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu6Z (Z:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyve