PDB entry 5qu4

View 5qu4 on RCSB PDB site
Description: Crystal Structure of swapped human Nck SH3.1 domain, 1.05A, orthorhombic form I
Class: signaling protein
Keywords: sh3 domain, adaptor, peptide binding, signaling protein, domain swap
Deposited on 2020-01-28, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu4a_
  • Chain 'B':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-86)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu4b1, d5qu4b2
  • Chain 'C':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu4c_
  • Chain 'D':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qu4A (A:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu4A (A:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5qu4B (B:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu4B (B:)
    smaeevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    ns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5qu4C (C:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu4C (C:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5qu4D (D:)
    sgglndifeaqkiewhegsenlyfqsmaeevvvvakfdyvaqqeqeldikknerlwlldd
    skswwrvrnsmnktgfvpsnyverkns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu4D (D:)
    vvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver