PDB entry 5qu3

View 5qu3 on RCSB PDB site
Description: Crystal Structure of domain swapped human Nck SH3.1, 1.01A, monoclinic
Class: signaling protein
Keywords: sh3 domain, adaptor, peptide binding, signaling protein, domain swap
Deposited on 2020-01-28, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-81)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu3a1, d5qu3a2
  • Chain 'B':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16333 (26-End)
      • expression tag (25)
    Domains in SCOPe 2.07: d5qu3b1, d5qu3b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qu3A (A:)
    sgglndifeaqkiewhegsenlyfqsevvvvakfdyvaqqeqeldikknerlwllddsks
    wwrvrnsmnktgfvpsnyverk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu3A (A:)
    sevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5qu3B (B:)
    sgglndifeaqkiewhegsenlyfqsevvvvakfdyvaqqeqeldikknerlwllddsks
    wwrvrnsmnktgfvpsnyverk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu3B (B:)
    sevvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyver