PDB entry 5qu1

View 5qu1 on RCSB PDB site
Description: Crystal Structure of the monomeric human Nck SH3.1 domain, triclinic, 1.08A
Class: signaling protein
Keywords: sh3 domain, adaptor, peptide binding, signaling protein, domain swap
Deposited on 2020-01-28, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu1a_
  • Chain 'B':
    Compound: cytoplasmic protein nck1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK1, NCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qu1b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qu1A (A:)
    sgglndifeaqkiewhegsenlyfqsevvvvakfdyvaqqeqeldikknerlwllddsks
    wwrvrnsmnktgfvpsnyverk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu1A (A:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5qu1B (B:)
    sgglndifeaqkiewhegsenlyfqsevvvvakfdyvaqqeqeldikknerlwllddsks
    wwrvrnsmnktgfvpsnyverk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qu1B (B:)
    evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk