PDB entry 5qs1

View 5qs1 on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of human Brachyury in complex with Z1954800564
Class: transcription
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, TRANSCRIPTION
Deposited on 2019-05-25, released 2019-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-box transcription factor T
    Species: Homo sapiens [TaxId:9606]
    Gene: TBXT, T
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qs1a_
  • Heterogens: CD, NZ1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qs1A (A:)
    gelrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadn
    hrwkyvngewvpggkpepqapscvyihpdspnfgahwmkapvsfskvkltnklngggqim
    lnslhkyeprihivrvggpqrmitshcfpetqfiavtayqneeitalkikyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qs1A (A:)
    elrvgleeselwlrfkeltnemivtkngrrmfpvlkvnvsgldpnamysflldfvaadnh
    rwkyvngewvpggkpepqapscvyihpdspnfgahwmkapvsfskvkltnklngggqiml
    nslhkyeprihivrvggpqrmitshcfpetqfiavtayqneeitalkikyn