PDB entry 5qq3

View 5qq3 on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of T. cruzi FPPS in complex with FMOPL000672a
Class: transferase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, TRANSFERASE
Deposited on 2019-03-12, released 2020-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qq3a_
  • Heterogens: LXA, SO4, ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qq3A (A:)
    gpmasmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnv
    aegflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpg
    vttqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsn
    kldpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlverv
    ahligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanyg
    ekdpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekth
    krkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qq3A (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygek
    dpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr