PDB entry 5qpr

View 5qpr on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of T. cruzi FPPS in complex with XST00001145b
Class: transferase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, TRANSFERASE
Deposited on 2019-03-12, released 2020-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.6700000000000002 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesyl Diphosphate Synthase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5qpra_
  • Heterogens: LVD, SO4, ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qprA (A:)
    gpmasmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnv
    aegflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpg
    vttqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsn
    kldpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlverv
    ahligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanyg
    ekdpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekth
    krkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qprA (A:)
    masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
    gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
    tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
    dpevaqpmttdfaeftpaiykrivkykttfytyllplvmgllvseaaasvemnlvervah
    ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygek
    dpakvavvkrlyskanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr