PDB entry 5qou

View 5qou on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of DCP2 (NUDT20) in complex with Z296300542
Class: hydrolase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, HYDROLASE
Deposited on 2019-02-22, released 2019-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dcp2 (nudt20)
    Species: Homo sapiens [TaxId:9606]
    Gene: DCP2, NUDT20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qoua_
  • Heterogens: EDO, DMS, ACT, LE7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qouA (A:)
    smgvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdi
    kdyickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmt
    pksklglapnkffmaipfirplrdwlsrrfgdssdsdngfsstgstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qouA (A:)
    gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
    yickdyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpks
    klglapnkffmaipfirplrdwlsrrfg