PDB entry 5qop

View 5qop on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of DCP2 (NUDT20) in complex with NUOOA000023a
Class: hydrolase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, HYDROLASE
Deposited on 2019-02-22, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dcp2 (nudt20)
    Species: Homo sapiens [TaxId:9606]
    Gene: DCP2, NUDT20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5qopa_
  • Heterogens: EDO, DMS, ACT, LDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5qopA (A:)
smgvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdi
kdyickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmt
pksklglapnkffmaipfirplrdwlsrrfgdssdsdngfsstgstp

    Sequence, based on observed residues (ATOM records): (download) 
    >5qopA (A:)
gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk
sklglapnkffmaipfirplrdwlsrrfg