PDB entry 5qoo

View 5qoo on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of DCP2 (NUDT20) in complex with FMOPL000144a
Class: hydrolase
Keywords: SGC - Diamond I04-1 fragment screening, PanDDA, XChemExplorer, HYDROLASE
Deposited on 2019-02-22, released 2019-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dcp2 (nudt20)
    Species: Homo sapiens [TaxId:9606]
    Gene: DCP2, NUDT20
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5qooa_
  • Heterogens: EDO, DMS, ACT, PEG, LDJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qooA (A:)
    smgvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdi
    kdyickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmt
    pksklglapnkffmaipfirplrdwlsrrfgdssdsdngfsstgstp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qooA (A:)
    gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd
    yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk
    sklglapnkffmaipfirplrdwlsrrfg