PDB entry 5qiy

View 5qiy on RCSB PDB site
Description: Covalent fragment group deposition -- Crystal Structure of OUTB2 in complex with PCM-0102954
Class: hydrolase/hydrolase inhibitor
Keywords: SGC - Diamond I04-1 fragment screening, XChemExplorer, PROTEASE OTUB2, DEUBIQUITINATING ENZYME OTUB2, hydrolase-hydrolase inhibitor complex
Deposited on 2018-08-10, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin thioesterase OTUB2
  Species: Homo sapiens [TaxId:9606]
  Gene: OTUB2, C14orf137, OTB2, OTU2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96DC9 (0-224)
    • conflict (43)
  Domains in SCOPe 2.08: d5qiya_
• Heterogens: J61, UNL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5qiyA (A:)
  fnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesll
  gksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndq
  sasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsq
  alsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilya