PDB entry 5qin

View 5qin on RCSB PDB site
Description: tgf-beta receptor type 2 kinase domain in complex with n- {4-[3-(6-methoxypyridin-3-yl)-1h-pyrrolo[3,2-b]pyridin-2- yl]pyridin-2-yl}acetamide
Class: transferase/transferase inhibitor
Keywords: kinase domain, transferase-transferase inhibitor complex, transferase
Deposited on 2018-08-05, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TGF-beta receptor type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: TGFBR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37173
      • engineered mutation (197)
      • engineered mutation (199)
      • engineered mutation (251)
      • engineered mutation (254)
      • engineered mutation (259)
      • engineered mutation (261)
    Domains in SCOPe 2.07: d5qina_
  • Heterogens: J2V, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qinA (A:)
    ghmhntellpieldtlvgkgrfaevykaklkqntseqfetvavkifpyeeyaswktekdi
    fsdinlkhenilqfltaeerktelgkqywlitafhakgnlqeyltrhviswedlrklgss
    largiahlhsdhtpcgrpkmpivhrdlkssnilvkndltcclcdfglslrldptlsvddl
    ansgqvgtarymapevlasamnlenvesfkqtdvysmalvlwemtsrcnavgevkdyepp
    fgskvrehpcvasmadnvladagrpeipsfwlnhqgiqmvcetltecwdhdpearltaqc
    vaerfselehldrlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qinA (A:)
    ellpieldtlvgkgrfaevykaklkqfetvavkifpyeeyaswktekdifsdinlkheni
    lqfltaeerktelgkqywlitafhakgnlqeyltrhviswedlrklgsslargiahlhsd
    htpcgrpkmpivhrdlkssnilvkndltcclcdfglslrldptlsvddlanqvgtaryma
    pevlasamnlenvesfkqtdvysmalvlwemtsrcnavgevkdyeppfgskvrehpcvas
    madnvladagrpeipsfwlnhqgiqmvcetltecwdhdpearltaqcvaerfsel