PDB entry 5qif

View 5qif on RCSB PDB site
Description: PanDDA analysis group deposition of models with modelled events (e.g. bound ligands) -- Crystal Structure of HAO1 in complex with Z31792168
Class: oxidoreductase
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, HAO1, XChemExplorer, OXIDOREDUCTASE
Deposited on 2018-05-22, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyacid oxidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HAO1, GOX1, HAOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5qifa_
  • Heterogens: FMN, GWS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5qifA (A:)
    smlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvae
    tdlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieeva
    eagpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklpp
    qlrmknfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgil
    rgddareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtd
    vlkalalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktl
    vrknplavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5qifA (A:)
    rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
    tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
    ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
    knfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdd
    areavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlka
    lalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk